missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
PRPSAP2 Polyclonal antibody specifically detects PRPSAP2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifica
Specifica
| Antigene | PRPSAP2 |
| Applicazioni | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Biotin |
| Formulazione | PBS |
| Alias gene | MGC117304, MGC126719, MGC126721, PAP4141 kDa phosphoribosypyrophosphate synthetase-associated protein, phosphoribosyl pyrophosphate synthase-associated protein 2, phosphoribosyl pyrophosphate synthetase-associated protein 2, PRPP synthase-associated protein 2 |
| Specie ospite | Rabbit |
| Immunogeno | Recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1).,, Sequence:, HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKP |
| Metodo di purificazione | Affinity purified |
| Quantità | 0.1 mL |
| Vedi altri risultati |
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?