missing translation for 'onlineSavingsMsg'
Learn More

AGPAT1 Antibody, Novus Biologicals™

Codice prodotto. 18237141 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
25 μL
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18237141 100 μL 100µL
18666338 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18237141 Fornitore Novus Biologicals N. del fornitore NBP257898

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

AGPAT1 Polyclonal specifically detects AGPAT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene AGPAT1
Applicazioni Western Blot, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulazione PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias gene 1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15
Simboli geni AGPAT1
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Metodo di purificazione Affinity Purified
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 10554
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.