missing translation for 'onlineSavingsMsg'
Learn More

AIG1 Recombinant Protein, Abnova

Human AIG1 full-length ORF recombinant protein with GST-tag at N-terminal

Marca:  Abnova H00051390-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16159982

  • 458.00€ / 25µg


Spedizione stimata
30-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Theoretical MW (kDa): 51.92
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MALVPCQALRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQERERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQHPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPF
LEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH25278
Solution
51390
AIG1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
AIG-1|DKFZp686F03136|FLJ10485|dJ95L4.1
AIG1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
51.92
8
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AIG1
Human
Yes
Videos
SDS
Documenti