missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Codice prodotto. 18145235 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
2 mg
5 mg
Dimensione della confezione:
2mg
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18145235 2 mg 2mg
18115332 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18145235 Supplier Novus Biologicals™ Supplier No. NBP229332

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

For use in research applications

TRUSTED_SUSTAINABILITY

Specifications

Specie ospite Human
Componenti Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Da utilizzare con (applicazione) Inhibition of Akt kinase activity
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantità 2 mg
Product Type AKT1/2/3 Inhibitor Peptide Set
Peso molecolare 4214
Inibitori AKT1/2/3
Forma Lyophilized

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.