missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Specifications
Specifications
| Specie ospite | Human |
| Componenti | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| Da utilizzare con (applicazione) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantità | 2 mg |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Peso molecolare | 4214 |
| Inibitori | AKT1/2/3 |
| Forma | Lyophilized |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?