missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AlphaB Crystallin/CRYAB Antibody, Novus Biologicals™

AlphaB Crystallin/CRYAB Antibody, Novus Biologicals™

Codice prodotto. 18603409 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18603409 0.1 mL 0.10mL
18649696 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18603409 Fornitore Novus Biologicals N. del fornitore NBP249246
 Articolo soggetto a restrizioni
Spedizione stimata: 01-12-2026
Aggiungi al carrello
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

AlphaB Crystallin/CRYAB Polyclonal antibody specifically detects AlphaB Crystallin/CRYAB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigene AlphaB Crystallin/CRYAB
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene alpha B crystallin, alpha(B)-crystallin, alpha-crystallin B chain, CRYA2alpha crystallin B chain, crystallin, alpha B, CTPP2, Heat shock protein beta-5, heat-shock 20 kD like-protein, HSPB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Cancer, Cell Biology, Cell Cycle and Replication, Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience, Neurotransmission, Protein Phosphatase, Sensory Systems, Signal Transduction, Tyrosine Kinases, Vision
Primario o secondario Primary
ID gene (immissione) 1410
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.