missing translation for 'onlineSavingsMsg'
Learn More

CD53 molecule, Mouse, Polyclonal Antibody, Abnova™

Codice prodotto. 16162891
Cambia vista
Click to view available options
Quantità:
50 μL
Dimensione della confezione:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
16162891 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16162891 Fornitore Abnova N. del fornitore H00000963B01.50uL

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Mouse polyclonal antibody raised against a full-length human CD53 protein.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq

Sequence: MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Specifica

Antigene CD53
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Descrizione Mouse polyclonal antibody raised against a full-length human CD53 protein.
Formulazione No additive
Gene CD53
N. accesso geni NM_000560.3
Alias gene MOX44/TSPAN25
Simboli geni CD53
Specie ospite Mouse
Immunogeno CD53 (NP_000551.1, 1 a.a. ∼ 219 a.a) full-length human protein.
Quantità 50 μL
Status giuridico RUO
Molecola intera Yes
Primario o secondario Primary
ID gene (immissione) 963
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Forma Serum
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.