missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16108292

FGF21, Mouse, Clone: 1A8, Abnova™

Codice prodotto. 16108292
Cambia vista
Click to view available options
Quantità:
100 μg
Dimensione della confezione:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
16108292 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16108292 Fornitore Abnova N. del fornitore H00026291M02.100ug
 Articolo soggetto a restrizioni
Spedizione stimata: 07-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Mouse monoclonal antibody raised against a full-length recombinant FGF21.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Specifica

Antigene FGF21
Applicazioni ELISA, Immunoprecipitation, Western Blot
Classificazione Monoclonal
Clone 1A8
Coniugato Unconjugated
Descrizione Mouse monoclonal antibody raised against a full length recombinant FGF21.
Formulazione PBS with no preservative; pH 7.4
Gene FGF21
N. accesso geni BC018404
Simboli geni FGF21
Specie ospite Mouse
Immunogeno FGF21 (AAH18404, 30 a.a. ∼ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Metodo di purificazione Unpurified
Quantità 100 μg
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 26291
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.