missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APPBP2 Antibody, R&D Systems™

APPBP2 Antibody, R&D Systems™

Codice prodotto. 18601974 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μg
25 μg
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18601974 25 μg 25µL
18684504 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18601974 Fornitore Novus Biologicals N. del fornitore NBP32131025ul
  • ONLINE EXCLUSIVE PRICE
    594.52€
    510.30€ / 25µL
    Risparmia 84.22€
    14% Sconto
 Articolo soggetto a restrizioni
Spedizione stimata: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

APPBP2 Polyclonal specifically detects APPBP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifica

Antigene APPBP2
Applicazioni Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulazione PBS, pH 7.2, 40% glycerol
Alias gene amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
Metodo di purificazione Affinity purified
Quantità 25 μg
Status giuridico RUO
Disciplina di ricerca Cancer
Primario o secondario Primary
ID gene (immissione) 10513
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.