missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APRIN Antibody, Novus Biologicals™

APRIN Antibody, Novus Biologicals™

Codice prodotto. 18445911 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18445911 25 μL 25µL
18239346 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18445911 Fornitore Novus Biologicals N. del fornitore NBP19012125ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

APRIN Polyclonal specifically detects APRIN in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene APRIN
Applicazioni Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias gene Androgen-induced proliferation inhibitorKIAA0979androgen induced inhibitor of proliferation, Androgen-induced prostate proliferative shutoff-associated protein AS3, androgen-induced shutoff 3, AS3APRIN, CG008, FLJ23236, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae), sister chromatid cohesion protein PDS5 homolog B
Simboli geni PDS5B
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Disciplina di ricerca Apoptosis, Cell Cycle and Replication, DNA Repair
Primario o secondario Primary
ID gene (immissione) 23047
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.