missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Aquaporin-12A Antibody, Novus Biologicals™

Aquaporin-12A Antibody, Novus Biologicals™

Codice prodotto. 18621408 Sfoglia Tutto Bio Techne Prodotti
Change view
Click to view available options
Quantità:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantità unitSize
18621408 25 μL 25µL
18274630 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18621408 Supplier Novus Biologicals Supplier No. NBP25469625ul

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Aquaporin-12A Polyclonal specifically detects Aquaporin-12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigene Aquaporin-12A
Applicazioni Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry-Paraffin 1:50 - 1:200
Formulazione PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias gene AQP-12, AQP12AQPX2aquaporin X2, aquaporin 12, aquaporin 12A, aquaporin-12A
Simboli geni AQP12A
Specie ospite Rabbit
Immunogeno This antibody was developed against a Recombinant Protein corresponding to amino acids:FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Disciplina di ricerca DNA replication Transcription Translation and Splicing
Primario o secondario Primary
ID gene (immissione) 375318
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.