missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Aquaporin-12A Polyclonal specifically detects Aquaporin-12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigene | Aquaporin-12A |
| Applicazioni | Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Diluizione | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulazione | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias gene | AQP-12, AQP12AQPX2aquaporin X2, aquaporin 12, aquaporin 12A, aquaporin-12A |
| Simboli geni | AQP12A |
| Specie ospite | Rabbit |
| Immunogeno | This antibody was developed against a Recombinant Protein corresponding to amino acids:FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?