missing translation for 'onlineSavingsMsg'
Learn More

ATP5J2 Antibody - Azide and BSA Free, Novus Biologicals™

Codice prodotto. 18623511 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18623511 0.02 mL 0.02mL
18619790 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18623511 Fornitore Novus Biologicals N. del fornitore NBP2923450.02ml

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

ATP5J2 Polyclonal antibody specifically detects ATP5J2 in Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigene ATP5J2
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS with 50% glycerol, pH7.3.
Alias gene ATP synthase f chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2, ATP5JLATP synthase subunit f, mitochondrial, F1F0-type ATPase subunit f, F1Fo-ATP synthase complex Fo membrane domain f subunit, F1Fo-ATPase, F1Fo-ATPase synthase f subunit
Specie ospite Rabbit
Immunogeno A synthetic peptide corresponding to a sequence within amino acids 1-94 of human ATP5J2 (NP_004880.1). MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Metodo di purificazione Affinity purified
Quantità 0.02 mL
Status giuridico RUO
Disciplina di ricerca Cancer, Endocrinology, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 9551
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.