missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATP6V1C1 Antibody - Azide and BSA Free, Novus Biologicals™

ATP6V1C1 Antibody - Azide and BSA Free, Novus Biologicals™

Codice prodotto. 18633870 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18633870 0.02 mL 0.02mL
18683081 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18633870 Fornitore Novus Biologicals N. del fornitore NBP2924010.02ml

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è attualmente disponibile o è stato dismesso.
La preghiamo di consultare la pagina del prodotto per individuare le possibili alternative.
 Visualizzare prodotti alternativi

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ATP6V1C1 Polyclonal antibody specifically detects ATP6V1C1 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigene ATP6V1C1
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS with 50% glycerol, pH7.3.
Alias gene ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1
Specie ospite Rabbit
Immunogeno A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Metodo di purificazione Affinity purified
Quantità 0.02 mL
Status giuridico RUO
Disciplina di ricerca Endocrinology, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 528
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.