missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CCBL1 (Human) Recombinant Protein

Human CCBL1 full-length ORF ( AAH33685, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000883-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162691

  • 458.00€ / 25µg


Spedizione stimata
30-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP
Specifica

Specifica

AAH33685
cysteine conjugate-beta lyase, cytoplasmic
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CCBL1
GST
883
Wheat germ expression system
25 μg
FLJ95217, GTK, KAT1, KATI, MGC29624
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documenti