missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CDK5 (Human) Recombinant Protein

Human CDK5 full-length ORF ( NP_004926.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001020-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16163021

  • 458.00€ / 25µg


Spedizione stimata
19-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Specifica

Specifica

NP_004926.1
cyclin-dependent kinase 5
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDK5
GST
1020
Wheat germ expression system
25 μg
PSSALRE
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti