missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18121204

Novus Biologicals™ Claudin-18 Recombinant Protein Antigen

Codice prodotto. 18121204 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
Dimensione della confezione:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18121204 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18121204 Fornitore Novus Biologicals™ N. del fornitore NBP232002PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLDN18. The Claudin-18 Recombinant Protein Antigen is derived from E. coli. The Claudin-18 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-32002. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 51208
Specie Human
Famiglia di proteine Claudin-18
Metodo di purificazione Chromatography
Purezza >80% by SDS-PAGE and Coomassie blue staining
Concentrazione 0.5mg/mL
Content And Storage Store at -20 C. Avoid freeze-thaw cycles.
Formulazione PBS and 1 M Urea, pH 7.4.
Da utilizzare con (applicazione) Antibody Competition
Simbolo del gene CLDN18
Tipo di etichetta Unlabeled
Peso molecolare M.W. (theoretical): 25 kDa
Product Type Claudin-18
Quantità 0.1 mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32002. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.