missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CNOX Antibody, Novus Biologicals™

CNOX Antibody, Novus Biologicals™

Codice prodotto. 18213425 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18213425 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18213425 Fornitore Novus Biologicals N. del fornitore NBP157364

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

CNOX Polyclonal specifically detects CNOX in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigene CNOX
Applicazioni Western Blot
Classificazione Polyclonal
Concentrazione 0.5 mg/ml
Coniugato Unconjugated
Diluizione Western Blot 1.0 ug/ml
Formulazione PBS, 2% Sucrose with 0.09% Sodium Azide
N. accesso geni Q8TC92
Alias gene candidate growth-related and time keeping constitutive hydroquinone (NADH)oxidase, Candidate growth-related and time keeping constitutive hydroquinone [NADH]oxidase, cCNOXConstitutive Ecto-NOX, Cell proliferation-inducing gene 38 protein, cNOX, CNOXbA64J21.1, ecto-NOX disulfide-thiol exchanger 1, FLJ10094, PIG38, proliferation-inducing protein 38
Simboli geni ENOX1
Specie ospite Rabbit
Immunogeno Synthetic peptides corresponding to ENOX1(ecto-NOX disulfide-thiol exchanger 1) The peptide sequence was selected from the middle region of ENOX1. Peptide sequence QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE.
Metodo di purificazione Affinity purified
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 55068
Test di specificità Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%.
Ricostituzione Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.