missing translation for 'onlineSavingsMsg'
Learn More

CNTD2 Antibody, Novus Biologicals™

Codice prodotto. 18472742 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25ul
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18472742 25ul 25µL
18084339 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18472742 Fornitore Novus Biologicals N. del fornitore NBP21385025ul

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è attualmente disponibile o è stato dismesso.
La preghiamo di consultare la pagina del prodotto per individuare le possibili alternative.
Visualizzare prodotti alternativi

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

CNTD2 Polyclonal specifically detects CNTD2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene CNTD2
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias gene cyclin N-terminal domain containing 2
Simboli geni CNTD2
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the amino acids: SRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVM
Metodo di purificazione Affinity Purified
Quantità 25ul
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 79935
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.