missing translation for 'onlineSavingsMsg'
Learn More

COG4 Antibody, Novus Biologicals™

Codice prodotto. 18272241 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18272241 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18272241 Fornitore Novus Biologicals N. del fornitore NBP155199

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

COG4 Polyclonal specifically detects COG4 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigene COG4
Applicazioni Western Blot
Classificazione Polyclonal
Concentrazione 0.5 mg/ml
Coniugato Unconjugated
Diluizione Western Blot 1.0 ug/ml
Formulazione PBS, 2% Sucrose with 0.09% Sodium Azide
N. accesso geni Q9H9E3
Alias gene CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519
Simboli geni COG4
Specie ospite Rabbit
Immunogeno Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR.
Peso molecolare dell'antigene 89 kDa
Metodo di purificazione Affinity purified
Quantità 100 μL
Status giuridico RUO
Disciplina di ricerca Golgi Apparatus Markers
Primario o secondario Primary
ID gene (immissione) 25839
Test di specificità This product is specific to Subunit or Isoform: 4.
Ricostituzione Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.