missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CSTA (Human) Recombinant Protein

Human CSTA full-length ORF ( AAH10379, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001475-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16163661

  • 302.00€ / 10µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Specifica

Specifica

AAH10379
cystatin A (stefin A)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSTA
GST
1475
Wheat germ expression system
10 μg
STF1, STFA
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti