missing translation for 'onlineSavingsMsg'
Learn More

DOK3 Antibody, Novus Biologicals™

Codice prodotto. 18679066 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μg
25 μL
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18679066 25 μL 25µL
18601078 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18679066 Fornitore Novus Biologicals N. del fornitore NBP26271725ul

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

DOK3 Polyclonal antibody specifically detects DOK3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigene DOK3
Applicazioni Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulazione PBS (pH 7.2) and 40% Glycerol
Alias gene docking protein 3, DOKL, Dok-like protein, Downstream of tyrosine kinase 3, FLJ22570, FLJ39939
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Metodo di purificazione Protein A purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 79930
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.