missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ EMP3 (Human) Recombinant Protein

Abnova™ EMP3 (Human) Recombinant Protein

Codice prodotto. 16154501
Cambia vista
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
16154501 25 μg 25µg
16144501 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16154501 Fornitore Abnova™ N. del fornitore H00002014P01.25ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Human EMP3 full-length ORF ( AAH09718, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

Specifica

Numero di accesso AAH09718
ID gene (immissione) 2014
Nome epithelial membrane protein 3
Metodo di preparazione Wheat germ expression system
Analisi di controllo qualità 125% SDS-PAGE Stained with Coomassie Blue
Quantità 25 μg
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene YMP
Simbolo del gene EMP3
Specie Wheat Germ (in vitro)
Tag proteine GST
Tampone 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vedi altri risultati Mostra meno risultati
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.