missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ERK1 Inhibitor Peptide Set

Codice prodotto. 18110564 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
2 mg
5 mg
Dimensione della confezione:
2mg
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18110564 5 mg 5mg
18116222 2 mg 2mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18110564 Fornitore Novus Biologicals™ N. del fornitore NBP2293335MG

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

For use in research applications

TRUSTED_SUSTAINABILITY

Specifica

Specie ospite Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Componenti ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Da utilizzare con (applicazione) Inhibition of Erk activation
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantità 5 mg
Product Type ERK1 Inhibitor Peptide Set
Peso molecolare 3795
Inibitori ERK1
Forma Lyophilized

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.