missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Specifica
Specifica
| Specie ospite | Human, Mouse, Rat, Hamster, Rabbit, Xenopus |
| Componenti | ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| Da utilizzare con (applicazione) | Inhibition of Erk activation |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantità | 2 mg |
| Product Type | ERK1 Inhibitor Peptide Set |
| Peso molecolare | 3795 |
| Inibitori | ERK1 |
| Forma | Lyophilized |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?