missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM123C Antibody, Novus Biologicals™

FAM123C Antibody, Novus Biologicals™

Codice prodotto. 18602906 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18602906 25 μL 25µL
18118568 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18602906 Fornitore Novus Biologicals N. del fornitore NBP23871925ul
  • ONLINE EXCLUSIVE PRICE
    548.71€
    470.40€ / 25µL
    Risparmia 78.31€
    14% Sconto
 Articolo soggetto a restrizioni
Spedizione stimata: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

FAM123C Polyclonal specifically detects FAM123C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene FAM123C
Applicazioni Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N. accesso geni Q8N944
Alias gene family with sequence similarity 123C
Simboli geni AMER3
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 205147
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.