missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GALK2 Antibody, R&D Systems™

GALK2 Antibody, R&D Systems™

Codice prodotto. 18610646 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18610646 0.1 mL 0.10mL
18694336 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18610646 Fornitore Novus Biologicals N. del fornitore NBP248900
  • ONLINE EXCLUSIVE PRICE
    751.30€
    708.75€ / 0.1mL
    Risparmia 42.55€
    5% Sconto
 Articolo soggetto a restrizioni
Spedizione stimata: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

GALK2 Polyclonal antibody specifically detects GALK2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigene GALK2
Applicazioni Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene EC 2.7.1, EC 2.7.1.157, galactokinase 2MGC1745, GalNAc kinase, GK2N-acetylgalactosamine kinase
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: EICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYK
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 2585
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.