missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GBL Antibody, Novus Biologicals™

GBL Antibody, Novus Biologicals™

Codice prodotto. 18134999 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18134999 0.1 mL 0.10mL
18693756 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18134999 Fornitore Novus Biologicals N. del fornitore NBP238491

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

GBL Polyclonal specifically detects GBL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene GBL
Applicazioni Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N. accesso geni Q9BVC4
Alias gene G protein beta subunit-like, Gable, GbetaL, GBLPop3, Lst8, LST8MGC111011, Mammalian lethal with SEC13 protein 8, mLST8, MTOR associated protein, LST8 homolog (S. cerevisiae), POP3, Protein GbetaL, target of rapamycin complex subunit LST8, TORC subunit LST8, WAT1
Simboli geni MLST8
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSP
Metodo di purificazione Affinity Purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Cancer, Hypoxia, mTOR Pathway
Primario o secondario Primary
ID gene (immissione) 64223
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.