missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ABTB1 Partial ORF (NP_742024, 271 a.a. - 370 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00080325-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160267

  • 458.00€ / 25µg


Spedizione stimata
27-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
Specifica

Specifica

NP_742024
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
RUO
ABTB1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80325
ABTB1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BPOZ|Btb3|EF1ABP|MGC20585|PP2259
ABTB1
Yes
Videos
SDS
Documenti