missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACP5 Partial ORF (AAH25414.1, 72 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00000054-Q02.25ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16013595

  • 482.88€ / 25µg


Spedizione stimata
28-05-2021
Aggiungi al carrello

Descrizione

Descrizione

This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq]

Sequence: NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Specifica

Specifica

AAH25414.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.31kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
RUO
ACP5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54
ACP5 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC117378|TRAP
ACP5
Yes
Videos
SDS
Documenti