missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AKNA Partial ORF (NP_110394.2, 1363 a.a. - 1439 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00080709-Q01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
Sequence: PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLFSpecifica
NP_110394.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.21kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF | |
RUO | |
AKNA | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
80709 | |
AKNA (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ31001/FLJ33184/KIAA1968/RP11-82I1.4 | |
AKNA | |
Recombinant | |
wheat germ expression system |