missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AP3S2 Partial ORF (NP_005820, 94 a.a. - 192 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010239-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162206

  • 458.00€ / 25µg


Spedizione stimata
30-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: VETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQF
Specifica

Specifica

NP_005820
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQF
RUO
AP3S2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10239
AP3S2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AP3S3|FLJ35955|sigma3b
AP3S2
Yes
Videos
SDS
Documenti