missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATG12 Full-length ORF (AAH12266, 1 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009140-P02.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16163322

  • 458.00€ / 25µg


Spedizione stimata
24-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Specifica

Specifica

AAH12266
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.14kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ATG12
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9140
ATG12 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APG12|APG12L|FBR93|HAPG12
ATG12
Yes
Videos
Documenti