missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C10orf48 Partial ORF (NP_775847, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00283078-Q01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
MKX is a member of an Iroquois (IRX) family-related class of 'three-amino acid loop extension' (TALE) atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix II of the homeodomain (Anderson et al., 2006 [PubMed 16408284]).[supplied by OMIM]
Sequence: MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDNSpecifica
| NP_775847 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.19kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN | |
| RUO | |
| MKX | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 283078 | |
| C10orf48 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C10orf48/IFRX/IRXL1/MGC39616 | |
| MKX | |
| Recombinant | |
| wheat germ expression system |