missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDC2L1 Partial ORF (NP_001778, 686 a.a. - 795 a.a.) Recombinant Protein with GST-tag at N-terminal

Codice prodotto. 16132941
Cambia vista
Click to view available options
Quantità:
10 ug
25 ug
Dimensione della confezione:
10µg
25µg
Codice prodotto. Quantità unitSize
16132941 10 ug 10µg
16142941 25 ug 25µg
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16132941

Marca: Abnova™ H00000984Q01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L2, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L2, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L2 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Several alternatively spliced variants of this gene have been reported. [provided by RefSeq]

Sequence: KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

Specifica

Numero di accesso NP_001778
Da utilizzare con (applicazione) Antibody Production, ELISA, Protein Array, Western Blot
Formulazione 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID gene (immissione) 984
Peso molecolare 37.84kDa
Nome CDC2L1 (Human) Recombinant Protein (Q01)
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 ug
Immunogeno KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Status giuridico RUO
Alias gene CDC2L2/CDK11/CDK11-p110/CDK11-p46/CDK11-p58/CLK-1/FLJ59152/PK58/p58/p58CDC2L1/p58CLK-1
Nome comune CDC2L1
Simbolo del gene CDC2L1
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Sistema di espressione wheat germ expression system
Forma Liquid
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.