Learn More
Abnova™ Human CDC2L1 Partial ORF (NP_001778, 686 a.a. - 795 a.a.) Recombinant Protein with GST-tag at N-terminal
Descrizione
This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L2, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L2, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L2 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Several alternatively spliced variants of this gene have been reported. [provided by RefSeq]
Specifica
Specifica
| Numero di accesso | NP_001778 |
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 984 |
| Peso molecolare | 37.84kDa |
| Nome | CDC2L1 (Human) Recombinant Protein (Q01) |
| Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantità | 10 ug |
| Immunogeno | KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF |
| Requisiti di stoccaggio | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Vedi altri risultati |
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.