missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLGN Partial ORF (NP_004353.1, 21 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | NP_004353.1 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 1047 |
| Peso molecolare | 36.74kDa |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16053825
|
Abnova™
H00001047-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16063825
|
Abnova™
H00001047-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq]
Sequence: FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHSpecifica
| NP_004353.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CLGN | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1047 | |
| CLGN (Human) Recombinant Protein (Q01) | |
| FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH | |
| RUO | |
| CLGN | |
| Recombinant | |
| wheat germ expression system |