missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CNTF Full-length ORF (NP_000605.1, 1 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | NP_000605.1 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 1270 |
| Peso molecolare | 49.3kDa |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16153361
|
Abnova™
H00001270-P01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 03-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16163361
|
Abnova™
H00001270-P01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 03-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq]
Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKMSpecifica
| NP_000605.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 49.3kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM | |
| RUO | |
| CNTF | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 1270 | |
| CNTF (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HCNTF | |
| CNTF | |
| Recombinant | |
| wheat germ expression system |