missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRLF1 Partial ORF (NP_004741, 135 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16130256
missing translation for 'orderingAttributeHoverText'
Quantità:
10 μg
25 μg
missing translation for 'unitSize'
10µg
25µg
This item is not returnable. View return policy
This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

Sequence: PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL

Specifications

Numero di accesso NP_004741
Da utilizzare con (applicazione) Antibody Production, ELISA, Protein Array, Western Blot
Formulazione 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID gene (immissione) 9244
Peso molecolare 36.3kDa
Nome CRLF1 (Human) Recombinant Protein (Q01)
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 25 μg
Immunogeno PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Status giuridico RUO
Alias gene CISS/CISS1/CLF/CLF-1/NR6
Nome comune CRLF1
Simbolo del gene CRLF1
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Sistema di espressione wheat germ expression system
Forma Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.