missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human CRLF1 Partial ORF (NP_004741, 135 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human CRLF1 Partial ORF (NP_004741, 135 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Codice prodotto. 16130256
Cambia vista
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
16130256 25 μg 25µg
16120256 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16130256 Fornitore Abnova™ N. del fornitore H00009244Q01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Visualizzare prodotti alternativi

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Used for AP, Array, ELISA, WB-Re

Sequence: PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL

Specifica

Numero di accesso NP_004741
Da utilizzare con (applicazione) Antibody Production, ELISA, Protein Array, Western Blot
Formulazione 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID gene (immissione) 9244
Peso molecolare 36.3kDa
Nome CRLF1 (Human) Recombinant Protein (Q01)
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 25 μg
Immunogeno PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Status giuridico RUO
Alias gene CISS/CISS1/CLF/CLF-1/NR6
Nome comune CRLF1
Simbolo del gene CRLF1
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Sistema di espressione wheat germ expression system
Forma Liquid
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.