missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CROP Full-length ORF (AAH56409.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00051747-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160333

  • 302.00€ / 10µg


Spedizione stimata
24-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
Specifica

Specifica

AAH56409.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LUC7A|OA48-18
CROP
Yes
wheat germ expression system
Liquid
51747
CROP (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
RUO
CROP
Wheat Germ (in vitro)
GST
Videos
Documenti