missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CTNNBL1 Partial ORF (AAH36739, 210 a.a. - 311 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00056259-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162173

  • 458.00€ / 25µg


Spedizione stimata
23-11-2020
Add to basket

Description

Description

Sequence: EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLENF
Specifications

Specifications

AAH36739
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLENF
RUO
CTNNBL1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
56259
CTNNBL1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C20orf33|FLJ21108|NAP|NYD-SP19|P14L|PP8304|dJ633O20.1
CTNNBL1
Yes
Videos
Documents