missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CXCR3 Partial ORF (NP_001495.1, 1 a.a. - 53 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002833-Q02.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16054075

  • 310.00€ / 10µg


Spedizione stimata
12-01-2021
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
Specifica

Specifica

NP_001495.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.57kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
RUO
CXCR3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2833
CXCR3 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD182|CD183|CKR-L2|CMKAR3|GPR9|IP10-R|Mig-R|MigR
CXCR3
Yes
Videos
SDS
Documenti