Learn More
Abnova™ Human DDX41 Partial ORF (NP_057306, 523 a.a. - 622 a.a.) Recombinant Protein with GST-tag at N-terminal
Descrizione
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression. [provided by RefSeq]
Specifica
Specifica
| Numero di accesso | NP_057306 |
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 51428 |
| Peso molecolare | 36.74kDa |
| Nome | DDX41 (Human) Recombinant Protein (Q01) |
| Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantità | 25 μg |
| Immunogeno | TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF |
| Requisiti di stoccaggio | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Vedi altri risultati |
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.