Abnova™ Human DECR2 Partial ORF (AAH10740.1, 49 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00026063-Q01.25ug

Codice prodotto. 16125306

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Sequence: MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI

Specifica

Numero di accesso	AAH10740.1
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	32.12kDa
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
Status giuridico	RUO
Nome comune	DECR2
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Da utilizzare con (applicazione)	Antibody Production, ELISA, Protein Array, Western Blot
ID gene (immissione)	26063
Nome	DECR2 (Human) Recombinant Protein (Q01)
Quantità	25 ug
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	PDCR/SDR17C1
Simbolo del gene	DECR2
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Suggerimenti di prodotto

Descrizione