missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DUT Partial ORF (AAH33645.1, 41 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001854-Q02.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16053915

  • 310.00€ / 10µg


Spedizione stimata
07-01-2021
Aggiungi al carrello

Descrizione

Descrizione

Sequence: GSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
Specifica

Specifica

AAH33645.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
RUO
DUT
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1854
DUT (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20622|dUTPase
DUT
Yes
Videos
SDS
Documenti