missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FARSLB Partial ORF (NP_005678, 234 a.a. - 341 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00010056-Q01.10ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified. [provided by RefSeq]
Sequence: PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVISpecifica
| NP_005678 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVI | |
| RUO | |
| FARSB | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10056 | |
| FARSLB (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FARSLB/FRSB/HSPC173/PheHB/PheRS | |
| FARSB | |
| Recombinant | |
| wheat germ expression system |