missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLJ45273 Partial ORF (NP_940863, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00164832-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162277

  • 458.00€ / 25µg


Spedizione stimata
19-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA
Specifica

Specifica

NP_940863
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA
RUO
LONRF2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
164832
FLJ45273 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ45273|MGC126711|MGC126713|RNF192
LONRF2
Yes
Videos
Documenti