missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FOXG1 Partial ORF (CAA52241.1, 164 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002290-Q03.25ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16053995

  • 467.00€ / 25µg


Spedizione stimata
22-12-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
Specifica

Specifica

CAA52241.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.45kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
RUO
FOXG1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2290
FOXG1 (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BF1|BF2|FHKL3|FKH2|FKHL1|FKHL2|FKHL3|FKHL4|FOXG1A|FOXG1B|FOXG1C|HBF-1|HBF-2|HBF-3|HBF-G2|HBF2|HFK1|HFK2|HFK3|KHL2|QIN
FOXG1
Yes
Videos
SDS
Documenti