missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GATA3 Partial ORF (NP_002042.1, 169 a.a. - 248 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002625-Q01.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16054045

  • 310.00€ / 10µg


Spedizione stimata
07-01-2021
Aggiungi al carrello

Descrizione

Descrizione

Sequence: TPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFG
Specifica

Specifica

NP_002042.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue
TPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFG
RUO
GATA3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2625
GATA3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HDR|MGC2346|MGC5199|MGC5445
GATA3
Yes
Videos
SDS
Documenti