missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOXB1 Partial ORF (NP_002135.2, 101 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | NP_002135.2 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 3211 |
| Peso molecolare | 37.73kDa |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16054155
|
Abnova™
H00003211-Q02.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16064155
|
Abnova™
H00003211-Q02.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq]
Sequence: LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFSpecifica
| NP_002135.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HOX2/HOX2I/Hox-2.9/MGC116843/MGC116844/MGC116845 | |
| HOXB1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3211 | |
| HOXB1 (Human) Recombinant Protein (Q02) | |
| LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF | |
| RUO | |
| HOXB1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |