missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ITGA2B Partial ORF (NP_000410.2, 504 a.a. - 602 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003674-Q01.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16064275

  • 302.00€ / 10µg


Spedizione stimata
22-10-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: CVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNV
Specifica

Specifica

NP_000410.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
CVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNV
RUO
ITGA2B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3674
ITGA2B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD41|CD41B|GP2B|GPIIb|GTA|HPA3
ITGA2B
Yes
Videos
Documenti