missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ITPKC Partial ORF (NP_079470, 63 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00080271-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160227

  • 458.00€ / 25µg


Spedizione stimata
20-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: EGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSLRTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEA
Specifica

Specifica

NP_079470
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSLRTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEA
RUO
ITPKC
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80271
ITPKC (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IP3KC
ITPKC
Yes
Videos
Documenti