missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLRG1 Partial ORF (NP_005801, 57 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010219-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162166

  • 302.00€ / 10µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM
Specifica

Specifica

NP_005801
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.67kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM
RUO
KLRG1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10219
KLRG1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
2F1|CLEC15A|MAFA|MAFA-2F1|MAFA-L|MAFA-LIKE|MGC13600
KLRG1
Yes
Videos
Documenti